LSLaunch SentinelReports
Early access — every report is free right now.
Home / Reports / LandingPagePro
L
VC Intelligence Report

LandingPagePro

Marketing — LandingPagePro offers a collection of 14 responsive landing page templates designed for rapid de…
Marketingpaid-only
■ Inactive
Verdict from HTTP liveness real
last probed Aug 24, 2026
Pulse 0.0 · 1/4
0.0
Pulse Index
1/4 families · real
0.0
30-day Δ
pulse momentum · real
17
HTTP probes
liveness history · real
8
Functional tags
observed attributes · real
Risk read derived from observed signals

Observed dead: the site no longer answers as a live product. Pulse has been flat over the last 30 days. Observation is liveness-only: no tracked press, repository, or traffic rank — existence is confirmed, momentum is unobserved.

HTTP liveness

real
17 probes · Jun 16, 2026Aug 24, 2026aliveredirecteddeadunverified

Signal telemetry

4 families · 1 observed · observed only
Liveness probereal
alive in 0% of 17 probesavg response 1001 ms
Developer tractionchecked · none
No public repository linked — GitHub signals are not tracked for this product.
Press & sentimentchecked · none
No coverage found in the tracked press corpus. Absence of press is itself a signal at this stage.
Web footprintreal
resolved host
nileinnovator.gumroad.com
edge
behind Cloudflare
server
cloudflare
Tranco rank
unranked
Domain age & certificate data not yet collected

Analyst read

generated from the observed metrics above · no external narrative

LandingPagePro's site returned a hard-dead response when we last probed it on Aug 24, 2026, so we mark it inactive. It has fewer than two observed signal families, so no Pulse Index is composed — the evidence strip shows what is and isn’t present. Observed footprint: 8 functional tags. It has no curated competitive-alternative edges yet, so the comparable set below is functional tag-similarity — read it with the confidence flags.

Comparable set

curated alternatives → functional tag-similarity
CompanyBasisOverlapPulse30d ΔStatus
makeitpretty.wtfmarketingsimilar88%8.00.0— unverified
Shopify Store Redesign or Makeoverecommercetag-overlap88%40.0+32.0● live
NFT Marketplace Developmentecommercetag-overlap88%42.50.0● live
Bookimbodesigntag-overlap78%40.00.0● live
MarketFlame Website Designdesigntag-overlap78%8.00.0— unverified
Opstartsproductivitytag-overlap78%0.00.0■ inactive
MOO Letter Press Cardsdesigntag-overlap78%48.40.0● live
Aikendesigntag-overlap78%40.0+7.2● live

Confidence reflects source and category coherence: curated = an editorially linked alternative; similar = strong functional tag-overlap in the same category; tag-overlap = shared tags only and may be noisy. Overlap is the shared functional-tag ratio (Jaccard) for tag-matched rows. Pulse is the observed-activity index real and 30d Δ its signed month change; a dash means insufficient observed history, never zero.

Structure

observed attributes
Business modelpaid-only
Liveness tiersunset
Competitive alternativesnone linked
Open sourceNo
Public APINo
Free tierNo
Enterprise tierNo

Funding & team

not in source

No disclosed funding in our sources. Funding data covers only ~1% of the corpus (462 rounds across 79K products), so absence here is unknown, not zero— we don't estimate a number we can't source.

RAW TELEMETRY last 14 probes
PROBEDHTTPORIGIN → RESOLVEDSERVERMSVERDICT
2026-08-24 14:49Z404nileinnovator.gumroad.comcloudflare973dead_404
2026-08-18 12:32Z404nileinnovator.gumroad.comcloudflare4822dead_404
2026-08-10 00:43Z404nileinnovator.gumroad.comcloudflare253dead_404
2026-08-08 05:18Z404nileinnovator.gumroad.comcloudflare302dead_404
2026-08-02 14:10Z404nileinnovator.gumroad.comcloudflare657dead_404
2026-07-30 16:55Z404nileinnovator.gumroad.comcloudflare1022dead_404
2026-07-18 14:52Z404nileinnovator.gumroad.comcloudflare1019dead_404
2026-07-15 09:24Z404nileinnovator.gumroad.comcloudflare213dead_404
2026-07-04 16:48Z404nileinnovator.gumroad.comcloudflare372dead_404
2026-07-03 03:26Z404nileinnovator.gumroad.comcloudflare1076dead_404
2026-06-23 15:29Z404nileinnovator.gumroad.comcloudflare342dead_404
2026-06-21 18:31Z404nileinnovator.gumroad.comcloudflare403dead_404
2026-06-21 18:31Z404nileinnovator.gumroad.comcloudflare296dead_404
2026-06-20 07:59Z404nileinnovator.gumroad.comcloudflare2258dead_404
Full redirect chains, response headers, and DNS records are not captured by the current probe.
Launch Sentinel tear sheet · LandingPagePro · as of 2026-08-28 · launchsentinel.com/reports/landingpagepro · liveness, pulse and press figures are observed data with provenance shown per panel.