LSLaunch SentinelReports
Early access — every report is free right now.
Home / Reports / Startup Landing Pages
S
VC Intelligence Report

Startup Landing Pages

Marketing — A service offering custom landing page design templates tailored for solopreneurs and indieprene…
Marketingsaas
● Verified live
Verdict from HTTP liveness real
last probed Aug 26, 2026
Pulse 40.0 · 1/4
40.0
Pulse Index
1/4 families · real
0.0
30-day Δ
pulse momentum · real
15
HTTP probes
liveness history · real
6
Functional tags
observed attributes · real
Risk read derived from observed signals

Verified live by HTTP probe across 15 observations. Pulse has been flat over the last 30 days. Observation is liveness-only: no tracked press, repository, or traffic rank — existence is confirmed, momentum is unobserved.

HTTP liveness

real
15 probes · Jun 16, 2026Aug 26, 2026aliveredirecteddeadunverified

Signal telemetry

4 families · 1 observed · observed only
Liveness probereal
alive in 100% of 15 probesavg response 1564 ms
Developer tractionchecked · none
No public repository linked — GitHub signals are not tracked for this product.
Press & sentimentchecked · none
No coverage found in the tracked press corpus. Absence of press is itself a signal at this stage.
Web footprintreal
resolved host
startup-landingpage.framer.website
edge
direct origin
server
Framer/6443c08
Tranco rank
unranked
Domain age & certificate data not yet collected

Analyst read

generated from the observed metrics above · no external narrative

Startup Landing Pages's listed site resolved live when we last probed it on Aug 26, 2026, so we mark it verified alive. It has fewer than two observed signal families, so no Pulse Index is composed — the evidence strip shows what is and isn’t present. Observed footprint: 6 functional tags. It has no curated competitive-alternative edges yet, so the comparable set below is functional tag-similarity — read it with the confidence flags.

Comparable set

curated alternatives → functional tag-similarity
CompanyBasisOverlapPulse30d ΔStatus
CeraMag – Life & Style Magazine Themedesigntag-overlap100%46.3+32.0● live
Affiliatedesigntag-overlap100%8.00.0— unverified
Petite Storiesdesigntag-overlap100%40.0+9.6● live
Shopify Store Redesign or Makeoverecommercetag-overlap86%40.0+32.0● live
makeitpretty.wtfmarketingsimilar86%8.00.0— unverified
NFT Marketplace Developmentecommercetag-overlap86%42.50.0● live
The Creative Classeducationtag-overlap83%16.00.0→ redirected
WritingBunnyproductivitytag-overlap83%40.00.0● live

Confidence reflects source and category coherence: curated = an editorially linked alternative; similar = strong functional tag-overlap in the same category; tag-overlap = shared tags only and may be noisy. Overlap is the shared functional-tag ratio (Jaccard) for tag-matched rows. Pulse is the observed-activity index real and 30d Δ its signed month change; a dash means insufficient observed history, never zero.

Structure

observed attributes
Business modelsaas
Liveness tierquiet
Competitive alternativesnone linked
Open sourceNo
Public APINo
Free tierNo
Enterprise tierNo

Funding & team

not in source

No disclosed funding in our sources. Funding data covers only ~1% of the corpus (462 rounds across 79K products), so absence here is unknown, not zero— we don't estimate a number we can't source.

RAW TELEMETRY last 14 probes
PROBEDHTTPORIGIN → RESOLVEDSERVERMSVERDICT
2026-08-26 10:00Z200startup-landingpage.framer.websiteFramer/6443c082051alive
2026-08-18 12:54Z200startup-landingpage.framer.websiteFramer/57d0062790alive
2026-08-10 01:05Z200startup-landingpage.framer.websiteFramer/0ccde4a1622alive
2026-08-08 05:41Z200startup-landingpage.framer.websiteFramer/0ccde4a1231alive
2026-08-05 18:04Z200startup-landingpage.framer.websiteFramer/21b5ebf2213alive
2026-07-30 17:17Z200startup-landingpage.framer.websiteFramer/5d364ee1305alive
2026-07-18 15:13Z200startup-landingpage.framer.websiteFramer/71ecfbf3190alive
2026-07-16 09:21Z200startup-landingpage.framer.websiteFramer/71ecfbf2397alive
2026-07-09 10:44Z200startup-landingpage.framer.websiteFramer/1a1b9252940alive
2026-07-04 03:57Z200startup-landingpage.framer.websiteFramer/1a1b925671alive
2026-06-21 22:14Z200startup-landingpage.framer.websiteFramer/2ea93c3449alive
2026-06-20 20:21Z200startup-landingpage.framer.websiteFramer/2ea93c3576alive
2026-06-19 10:22Z200startup-landingpage.framer.websiteFramer/2ea93c31073alive
2026-06-18 01:04Z200startup-landingpage.framer.websiteFramer/31fe4881387alive
Full redirect chains, response headers, and DNS records are not captured by the current probe.
Launch Sentinel tear sheet · Startup Landing Pages · as of 2026-08-28 · launchsentinel.com/reports/startup-landing-pages · liveness, pulse and press figures are observed data with provenance shown per panel.